Protein Info for Rru_A0840 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 387 to 412 (26 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 334 (305 residues), 46.8 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K05373, MFS transporter, putative signal transducer (inferred from 100% identity to rru:Rru_A0840)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW54 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Rru_A0840 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MRRTTLAHRSRTTSGYASSVLGLVLAVGGVYVSQTMVSMIAMQSLPTLLREAGVPLELLG
MSAVFMVPWVLKVLWAPAIERLRLPAGDPRRRSKAIILCGQGLLAAVFAGLAFLHWGASL
EGFLSVDVFLALMATAVLAASVDVASDGMVVDHLDAKTRPLGNAAQVGGAYIGLLLGTSL
FLVICARWGLSAALLCTSALLVLLSGPLVAFREQRRSLAEADHRPSLGFALRRQEVWVGI
MAITCLEAGVRTATVMVGPLLIDRGASLELIGWMFGGFTVVAGLAGTVAGALFVRWLGAW
KAVFLAYGMQALVLSALALAAEADFRLLTVLVGLKFMLMACGLLTSYSALMGLSSPKQAG
VDFTVFQCANALISLVGGVLGGWLAGIWGYGACFAVAAAFAGMSTLGVAARVHALGYWHG
WRAEPSARSPDLDLRREEI