Protein Info for Rru_A0828 in Rhodospirillum rubrum S1H

Annotation: CRISPR-associated helicase Cas3, core (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 TIGR01596: CRISPR-associated endonuclease Cas3-HD" amino acids 20 to 178 (159 residues), 112.9 bits, see alignment E=1.8e-36 PF01966: HD" amino acids 20 to 111 (92 residues), 28.7 bits, see alignment E=3.5e-10 PF18019: Cas3_HD" amino acids 39 to 117 (79 residues), 24.9 bits, see alignment E=4.9e-09 PF00270: DEAD" amino acids 236 to 409 (174 residues), 39.8 bits, see alignment E=9.9e-14 PF04851: ResIII" amino acids 248 to 380 (133 residues), 28.7 bits, see alignment E=3e-10 TIGR01587: CRISPR-associated helicase Cas3" amino acids 249 to 581 (333 residues), 104.1 bits, see alignment E=8.6e-34 PF22590: Cas3-like_C_2" amino acids 468 to 562 (95 residues), 42 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: K07012, (no description) (inferred from 100% identity to rru:Rru_A0828)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW66 at UniProt or InterPro

Protein Sequence (752 amino acids)

>Rru_A0828 CRISPR-associated helicase Cas3, core (NCBI) (Rhodospirillum rubrum S1H)
MYYAHSLETGGDKTRWQPAADHAFATGHLAAGFAQSFGAEKAARLAGLLHDLGKYCRAFQ
ARLEGAPERVDHATAGAITVRALLAGSSDRWDRTLGEILSYVIAGHHGGLPDWQGLADRL
KADLSGLDPVWRDEIAVAPQGLAPSLTPHPSKERLPFQLAFLGRMIFSCLVDADFKDTEA
FYEREAGTRSDRLWPLLPAIIDRLIARFNDHMATKAPLAGEPVSAVTLLRQDVLAQARAR
AAMSEGLFTLTVPTGGGKTLASLGFALDHAKRHGLERIIFAIPFTSILDQTAAVFRDVLG
EGVILEHHSAIEAEEKARREPPQQRDKLRLAMEDWAAPLILTTTVQLFESLFANRPARCR
KLHSIARSVIVLDEAQTLPLPLLKPCVAAIDELTRNYKASVVLCTATQPALDRRRFAAGD
DMGLDLAGRELAPDPGALAARLVRVTLRQAGVLSDEDVVTDLADPPQALVIVNTRKHALA
LYRRAVEAGLEGVVHLSTRHYGAHRRAILDDVRQRLDRGLPCRLIATSLVEAGVDVDFPR
VWRAEGGLDQIAQAAGRCNREGRRPVEDSIVTVFRAADHKPPAAVAQLAAAYGRIAQNHA
NPFSPAALEDYFREVYWSKGPGLDEHKILKAFAWDRSGGTLNYKRVAEDFRMIDSGMAPV
IIGRDAQARAALALLGRPDARAGQVARLLQPYLVQVPPPARMALITNGHVRFAEERSFGD
QFAVLTADSLYRDDTGLLWEDAGYLDLEQSIF