Protein Info for Rru_A0801 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 99 to 131 (33 residues), see Phobius details amino acids 139 to 172 (34 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF12911: OppC_N" amino acids 30 to 73 (44 residues), 33.8 bits, see alignment 2.6e-12 PF00528: BPD_transp_1" amino acids 115 to 295 (181 residues), 90.3 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 45% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to rru:Rru_A0801)

MetaCyc: 43% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW90 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Rru_A0801 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MTLSAWLFTETPASRRQARWGALARGGVALLGNRLVCGGLAVVIALGVVAVFAPALAPYD
PLVQDLSQRLRPPSAAHWLGTDHLGRDIFSRVLCGTPITLSIVTIAALTVLPVSLIIGMV
AGFFGGIVDAVLMRTTDVFLSFPLLVLALALAAALGPGLVNAVIAIALTAWPPLARLVRA
ETRRLKQADFVAATRLQGASALRLLSFDILPLVLPAALTRLSLDLAGMILIAASLGFLGL
GAQPPSPEWGAMVAAGRTFLMDQWWVATLPGVAIFIVSFAFNLLGDGVSEVLDPKE