Protein Info for Rru_A0798 in Rhodospirillum rubrum S1H

Annotation: 7-keto-8-aminopelargonate synthetase and related enzymes-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 39 to 172 (134 residues), 75.5 bits, E=2.3e-25

Best Hits

KEGG orthology group: K00643, 5-aminolevulinate synthase [EC: 2.3.1.37] (inferred from 100% identity to rru:Rru_A0798)

Predicted SEED Role

"5-aminolevulinate synthase (EC 2.3.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.3.1.37)

MetaCyc Pathways

• tetrapyrrole biosynthesis II (from glycine) (4/4 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• 2-amino-3-hydroxycyclopent-2-enone biosynthesis (2/4 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (13/26 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.37

Use Curated BLAST to search for 2.3.1.37

Sequence Analysis Tools

See Q2RW93 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Rru_A0798 7-keto-8-aminopelargonate synthetase and related enzymes-like (NCBI) (Rhodospirillum rubrum S1H)
MPESAHDSPLRPPAVPPLREPPSGQAVAVIGAGTMGRGIAAPQAIVDAVRSYAPAFVFST
SSPAPVVAAALAALTYNTRHPELRRRLLDRVAEVKAGFKRLGIPLVSDDSHVLPVLVGDP
HRCKEISRRLLDDFGIYVQPVNAPTVPEGTERLRVTPTAAHSGDDVKALLSAFDKVWNTV
TPGVA