Protein Info for Rru_A0788 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00005: ABC_tran" amino acids 21 to 169 (149 residues), 118.9 bits, see alignment E=4.1e-38 PF09383: NIL" amino acids 268 to 339 (72 residues), 89.5 bits, see alignment E=1.5e-29

Best Hits

Swiss-Prot: 100% identical to METN_RHORT: Methionine import ATP-binding protein MetN (metN) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 100% identity to rru:Rru_A0788)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWA3 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Rru_A0788 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MIVTEALTKAFSGPFGAIEVLRGIDLEIAKSEVFGVIGRSGAGKSTLVRCLNLLERPTGG
RVWVGGRELTSFDERSLRQARRDIGMIFQHFNVLSSRTAADNIALPLELVGLPGPVIRRR
VAELLDLVGLTDKGEAYPAELSGGQKQRVGIARALASKPSVLLCDEATSALDPETTKSIL
ALLKDINRRLGLTIVLITHEMHVIKDIADRVAVLDHGRVVEQGRVFDVFTDPQHAVTRAF
VHEVLNRDLPEVLVPRLATTRLEGGPVIWRITFTGPSANDPVVSEMVRRFGLSFNILYGH
IDYIQGLPYGTLVVEAAGTESARHAALAYLSQKNLSVEVLGHVATPDPVTA