Protein Info for Rru_A0787 in Rhodospirillum rubrum S1H

Annotation: cysteine synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00291: PALP" amino acids 10 to 300 (291 residues), 242.4 bits, see alignment E=6.8e-76 PF00571: CBS" amino acids 342 to 387 (46 residues), 26.6 bits, see alignment 6.2e-10 amino acids 398 to 450 (53 residues), 32.6 bits, see alignment 8.1e-12

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 100% identity to rru:Rru_A0787)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWA4 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Rru_A0787 cysteine synthase (NCBI) (Rhodospirillum rubrum S1H)
MTAPVDLLAQIGHTPIVRLDHLDTGPCSLFVKLESQNPSGSIKDRIAVSMIDAAERDGRL
KPKGRIVEATAGNTGLALALVAARRGYHLTLVIPDKMSREKIAHVRAMGAEVVLTRSDIG
KGHPAYYQDLAQRIADETGAFFTDQFNNPDNPIAHETGTGPEIWEQMDGRVDAVVAGVGS
GGTLTGLSRFFARVSPQTDIVLADPKGSILADYVTSGRIGAAGSWLVEGIGEDFVPPVSD
LSRVTHAYTIPDGESFATARGVLRQEGLLIGSSSGTLLAAALRYCREQTSPKRVVSFVCD
SGNKYLSKMYNDFWMADQGLSNRPRFGDLRDLIARRQDEGAVVSVAPGDTLAIAYQRMKL
YDVSQLPVLDGTRCVGLIDESDVLLSLRERGGLFDVAVSAAMSTDLETVGPDADADHLVG
LFDRGRVAIVVDDSGFLGLITRIDFLNHLRGKAA