Protein Info for Rru_A0781 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 157 to 253 (97 residues), 49.6 bits, see alignment E=2.3e-17 PF00528: BPD_transp_1" amino acids 175 to 353 (179 residues), 48.9 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A0781)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWB0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Rru_A0781 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MTLIADTLDSPAPPRRAPDTSLSGWARWREGLFGSLGNTLLTLLVLAVLAWVVPPLVRWA
VIDAVWSGPAEACAARSGACWAFLAEKTRFILFGLYPAAAQGAPALASLLLGALLVASGL
PRLWGRNLLVAWILVPLLAVLVMAGVFSGLRVGTDQWGGLPLTLLLTTVAMGGAFPLAVV
LALARRSRFRLFRLMAVCVIEGVRGVPLITVLYGAILLVPLMLPAGTAIDKLLRAQGAIL
LFTASYLAEIIRAGLQAIPPGQYEAARSLGLGYGLTMRLVVLPQALRLVIPSIVTLAIGI
LQDTTLVAVIGIHDLLSASKLAATDPDWLGFYTEGFCLVATLYFALCFAASRYSLWLERY
LARGQGY