Protein Info for Rru_A0780 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 169 to 195 (27 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 81 to 140 (60 residues), 47.6 bits, see alignment E=9.7e-17 PF00528: BPD_transp_1" amino acids 101 to 377 (277 residues), 47.3 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K09970, general L-amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A0780)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWB1 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Rru_A0780 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MRALGRKITWILAAWWGERPLSQLAVLLGVFALFSVLGANTVDNLGRLGITVGFGYLDHP
ANFEIGESLVAYTSGDSYARALGVGILNTALVSIIGCLLATLLGVALGIGRLSANLLISR
AVQLYVEVIRNTPLLLQLFFWSATIHALPGPRQAFEPLTGVFLTNRGLYMPALAMDGAAV
FSLLLLGGGALAGVVRILVHERRHGPMERAAKTALLGAVAVLLLGVLALCLGGAVSVEPP
RLGGFNITGGWVLSPEFLALLVGLVINASAVICEIVRSGIEAVPEGQWEAARSLGLTRGR
TLRLVVLPQALRVVIPLMTSSYLSLTKNSSLAVAIGFPDLVSVVNTSANQTGHVFEAIAL
MMAVYLTISLTVSAALNFYNHRLSLGR