Protein Info for Rru_A0776 in Rhodospirillum rubrum S1H

Annotation: Aspartate/tyrosine/aromatic aminotransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF00155: Aminotran_1_2" amino acids 30 to 372 (343 residues), 181.1 bits, see alignment E=7.7e-57 PF00266: Aminotran_5" amino acids 70 to 183 (114 residues), 26.2 bits, see alignment E=7.7e-10 PF01041: DegT_DnrJ_EryC1" amino acids 89 to 197 (109 residues), 33.4 bits, see alignment E=5.9e-12 PF01053: Cys_Met_Meta_PP" amino acids 91 to 199 (109 residues), 31.2 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 44% identical to DAPC_MYCTO: Probable N-succinyldiaminopimelate aminotransferase DapC (dapC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0776)

MetaCyc: 44% identical to 2-oxo-4-methylthiobutanoate-glutamine aminotransferase monomer (Solanum lycopersicum)
RXN-15650 [EC: 2.6.1.117]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1 or 2.6.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWB5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Rru_A0776 Aspartate/tyrosine/aromatic aminotransferase (NCBI) (Rhodospirillum rubrum S1H)
MIPPGNAIFAAAGASVFETMSQLAHEHGAINLGQGFPEALEPPEVIEAAARALRDGPHQY
PSAWGVPALRQAVAEANERFWGLATDPTREVLVTSGATEALAACFLGLLNAGDEVIVLQP
AFDCYQAQIRRAGAVAVGVALSAPDWTLPRAALAAAITPRTRAIVLNTPMNPCGKVFDGP
ELDFIAELLIAHDLVAICDEVYEHLTFEDRAPLPLMTRPGVRARCLRIGSAGKTFSVTGW
KIGYVSGDAALLAPVARAHQVTTFSTPPFLQTAVAHGLRLADGYFDGLRATLRTRRDLLS
RGLTEAGFEVLGCQGTYFLLAGTDGAEDDVGFCRRLVEEAGVTAIPLSGFFTPAGRRPLV
RFCFAKRLETLEGGIARLVAWRGGQRWRRAS