Protein Info for Rru_A0766 in Rhodospirillum rubrum S1H

Annotation: Adenosine deaminase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ADE_RHORT: Adenine deaminase (Rru_A0766) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 100% identity to rru:Rru_A0766)

MetaCyc: 30% identical to adenosine deaminase (Escherichia coli K-12 substr. MG1655)
Adenosine deaminase. [EC: 3.5.4.4]; 3.5.4.4 [EC: 3.5.4.4]

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

purine deoxyribonucleosides degradation I (4/4 steps found)
purine nucleotides degradation II (aerobic) (9/11 steps found)
purine deoxyribonucleosides degradation II (3/3 steps found)
purine ribonucleosides degradation (5/6 steps found)
adenine and adenosine salvage III (3/4 steps found)
superpathway of purine deoxyribonucleosides degradation (5/7 steps found)
adenine and adenosine salvage V (2/3 steps found)
adenosine nucleotides degradation II (3/5 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWC5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Rru_A0766 Adenosine deaminase (NCBI) (Rhodospirillum rubrum S1H)
MAVDPAFLHALPKVELHLHIEGSLEPEMMVALAERNGLRLPYASVEAVRAAYDFQNLQDF
LDLYYQGMAVLRTERDFEDLAMAYFQRAAAQNVLHAEIFFDPQGHTARGVALEAVIAGLT
SARKRAEAELGVSSELILSFLRHLSEEEAFATLEEALPHRDQFIGVGLDSSEVGHPPAKF
ARVFARARAEGLRLVAHAGEEGPPDYVREALDLLAIDRLDHGNRALEDEALIERLIAEGM
ALTVCPLSNLKLRVVDDLGAHPLKAMLERGLKATINSDDPSYFGGYMLENMAAVAEALAL
ETHHLRTLTANAIDASFASPARKAEMHARLAAVN