Protein Info for Rru_A0756 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details PF01595: CNNM" amino acids 8 to 199 (192 residues), 170.2 bits, see alignment E=5.7e-54 PF00571: CBS" amino acids 214 to 271 (58 residues), 20.2 bits, see alignment E=9.3e-08 amino acids 283 to 333 (51 residues), 34.1 bits, see alignment 4.4e-12 PF03471: CorC_HlyC" amino acids 350 to 426 (77 residues), 84.8 bits, see alignment E=5e-28

Best Hits

KEGG orthology group: K03699, putative hemolysin (inferred from 100% identity to rru:Rru_A0756)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWD5 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Rru_A0756 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MIAVEIAVIVLLMLLNGLFAMSELAMVSSRRARLQAMADRHVPGARIALRLTEDPGRFLS
TVQIGITLVGVVAGAYGGATLGDRAGECLETIPALAGWGRFLGVGGVLLLITFLSIVLGE
LIPKRIALTNPERTACVVAGLMRALSRIAAPFVWLLAASTEMALRLLGIHGSEGTTVTEE
EVRALISEGTEAGVFAPEEQEMIRGVLRLGDRTVRAVMTPRPEVVWLDLEEPTQALLLQI
GSGSHSSYPVCRGQLDEIVGIVHTRDLLAAAVRGKPLNLEAAMVRPLVVHDGMAILRLLD
LMKANRSYLAVVVDEYGSVEGVVTLTDILESIAGDLPDADEDSEVAAVPRADGSWLVEGW
MPIDEFEDTLHLRDLRDGDDFQTVAGLVLRELGRIPSAGDVFERDGIRFEVVDMDRRRID
KILVTPLPSSQAEGDI