Protein Info for Rru_A0742 in Rhodospirillum rubrum S1H

Annotation: Ubiquinone biosynthesis O-methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 13 to 241 (229 residues), 264.5 bits, E=3.3e-83
• PF13489: Methyltransf_23
  • amino acids 59 to 216 (158 residues), 70.6 bits, E=3.3e-23
• PF13847: Methyltransf_31
  • amino acids 64 to 184 (121 residues), 37.8 bits, E=4e-13
• PF08242: Methyltransf_12
  • amino acids 69 to 161 (93 residues), 48.1 bits, E=4e-16
• PF08241: Methyltransf_11
  • amino acids 69 to 161 (93 residues), 65.4 bits, E=1.6e-21
• PF13649: Methyltransf_25
  • amino acids 69 to 160 (92 residues), 56.7 bits, E=8.1e-19

Best Hits

Swiss-Prot: 100% identical to UBIG_RHORT: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to rru:Rru_A0742)

MetaCyc: 55% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

See Q2RWE9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Rru_A0742 Ubiquinone biosynthesis O-methyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MSATTSGTASAAELAKFSAMADAWWDPEGDFKPLHKFNPVRIAFLRDHFAAHFGRDIEAP
RPFEGLSLLDIGCGGGLLCEPFARLGFAVTGIDAAERNIGTASVHAERAGLPLTYRCAMP
EDLVAEGKTFDAVLTMEVVEHVADVRLFLDSVGQLCRPGGAVGAATLNRTLKSLALAKVG
AEYVLRWLPRGTHDWRKFMKPSELTAGLREAGLSVDAIAGMTFDPFSGTWSQTTDVSVNY
MLFATRAAA