Protein Info for Rru_A0741 in Rhodospirillum rubrum S1H

Annotation: Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details PF25487: ETR1_N" amino acids 27 to 124 (98 residues), 77 bits, see alignment E=2.3e-25 PF08448: PAS_4" amino acids 208 to 286 (79 residues), 26.1 bits, see alignment E=1.3e-09 PF07536: HWE_HK" amino acids 298 to 380 (83 residues), 77.5 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0741)

Predicted SEED Role

"sensor histidine kinase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWF0 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Rru_A0741 Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MFSLIDSLVGETALLPHGQCLLWDTPLLALHAVSDALIALAYFAIPLAIVIFVRRRPGLE
PLHLALALLFAVFIVACGLSHISSVVTLWIPAYLTQGLIKAATAVVSLVTAFVLFALIPR
LLAIPSPAELREANRRLGQEAALRQGMVEDLIVARADLERRVEERTRAAVKIMENFEVTL
RGSAVTIFQQDLDLRYTWIHNLRPPLVASDYIGRTPRQALPPEAAAVIEPFQREVLRTGV
KDRLILAISRGLDEGVWYDIQSEPLRDDAGVISGLASVAVDITSQKAGEQQLRVLMRELT
HRSKNLLAVVQGIARQSAANVPDVKTFTERFGARLQALGESHDILVSTDWRGAAIPDLAR
AHLGHFLAVSKERLTLRGPDILLSPEATQQIGLALHELSTNAAKYGALSNDGGRVEITWE
TRPSPLGVDLVLIWREIDGPPVVPSERTGFGHIMVTYLVPRSLRGTATLTPAAEGMLWTL
TFPLFIRQNPHPPATPTA