Protein Info for Rru_A0733 in Rhodospirillum rubrum S1H

Annotation: Peptidase M24A, methionine aminopeptidase, subfamily 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR00500: methionine aminopeptidase, type I" amino acids 18 to 257 (240 residues), 308.7 bits, see alignment E=1.5e-96 PF00557: Peptidase_M24" amino acids 20 to 248 (229 residues), 171.3 bits, see alignment E=1.2e-54

Best Hits

Swiss-Prot: 65% identical to MAP1_RICPR: Methionine aminopeptidase (map) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to rru:Rru_A0733)

MetaCyc: 52% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWF8 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Rru_A0733 Peptidase M24A, methionine aminopeptidase, subfamily 1 (NCBI) (Rhodospirillum rubrum S1H)
MNQTAQRAQQVTIHGLEGFEGMRRAGRLAAETLDFITPYIVPGATTEDLDRLCAEFMADN
GAISATLNYRGYPKSICTSINHVVCHGIPSEDKILHDGDIMNIDVTPILDGWYGDSSRMY
YVGEPKVKAKRLVEATYECLMRGIAVVKPGATLGDIGYAIQSYAEGLKFSVVRDFCGHGL
GQVFHQPPNVMHFGRKGQGMTLREGMIFTIEPMINTGRADTKILSDGWTAVTRDKSLSAQ
FEHSIGVTADGCEIFTLSPKGWHCPPYTEAP