Protein Info for Rru_A0732 in Rhodospirillum rubrum S1H

Annotation: DNA repair protein RadC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00608: DNA repair protein RadC" amino acids 31 to 242 (212 residues), 215.9 bits, see alignment E=2.9e-68 PF04002: RadC" amino acids 125 to 242 (118 residues), 145.4 bits, see alignment E=3.7e-47

Best Hits

Swiss-Prot: 55% identical to Y700_RHOP2: UPF0758 protein RPB_0700 (RPB_0700) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to rru:Rru_A0732)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWF9 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Rru_A0732 DNA repair protein RadC (NCBI) (Rhodospirillum rubrum S1H)
MTPASGETPPNKAVVAPEKAPLPHYSGHRARLRDRFLANPDGLPDYELLELLLFQANPRG
DVKPLAKALLATFGSFARVISASPEALRRVDGVGDAAVAALKTAEASAHRLLKGEVMNQP
VLGAWDRVLDYCHATMDHRPIEQFRVLFLDNRNRLIADELQQTGTINHTPVYPREVARRA
LELHAAAIIMVHNHPSGDPAPSAADQDMTLQVRDALRAVGVGLHDHIVVARGGHVSFRSQ
GLF