Protein Info for Rru_A0703 in Rhodospirillum rubrum S1H

Annotation: Molybdate ABC transporter, permease protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 13 to 223 (211 residues), 230.2 bits, see alignment E=9.9e-73 PF00528: BPD_transp_1" amino acids 30 to 223 (194 residues), 66.7 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 66% identical to MODB_ECO57: Molybdenum transport system permease protein ModB (modB) from Escherichia coli O157:H7

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to rru:Rru_A0703)

MetaCyc: 66% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWI8 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Rru_A0703 Molybdate ABC transporter, permease protein (NCBI) (Rhodospirillum rubrum S1H)
MPLLTPAETDALMLSLKVSTWGIAGSLPLGIAFAWLLARRTFPGKTILDGLIHLPLVLPP
VVIGYLLLVTLGRNGAVGALLYDWFGLTLAFTWRGAAVASAVIAFPLMVQAIRLSIEGVD
RGLESAARTLGAGPLRTFFTVTLPLVAPGILTGVILGFARCLGEFGATITFVSNIPGQTR
TLPLALYTQTQIPNGEVAAGRLCLISITVAMIALLASEFLSRRVNRIIQG