Protein Info for Rru_A0689 in Rhodospirillum rubrum S1H

Annotation: Cysteine--tRNA ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 458 (456 residues), 503.5 bits, see alignment E=3.6e-155 PF01406: tRNA-synt_1e" amino acids 16 to 314 (299 residues), 401 bits, see alignment E=9.4e-124 PF00133: tRNA-synt_1" amino acids 221 to 301 (81 residues), 26.7 bits, see alignment E=5.9e-10 PF09334: tRNA-synt_1g" amino acids 256 to 294 (39 residues), 22.1 bits, see alignment 1.5e-08 PF09190: DALR_2" amino acids 341 to 392 (52 residues), 44.8 bits, see alignment 3.8e-15 PF23493: CysS_C" amino acids 408 to 457 (50 residues), 38.1 bits, see alignment 3.3e-13

Best Hits

Swiss-Prot: 100% identical to SYC_RHORT: Cysteine--tRNA ligase (cysS) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to rru:Rru_A0689)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWK2 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Rru_A0689 Cysteine--tRNA ligase (NCBI) (Rhodospirillum rubrum S1H)
MTLHIHNTMTRTKEVFEPLDPGHVRLYVCGPTVYDRAHIGNARPVIVFDLLARLLRRLYP
QVTYVRNITDVDDKINARASASGRTIGEITEETTRLFHEDMAELGALPPDVEPRATAHIA
DMVAMIERLIAKGHAYEAEGHVLFSVPSMGAYGSLSGRSMDDMIAGARVEVAPYKRDPAD
FVLWKPSDASLPGWDSPWGRGRPGWHIECSAMSSRYLGPSFDIHGGGLDLIFPHHENEIA
QSVCCNGPGTFARYWMHNGYLMVEGEKMSKSLGNFVTVRDLLDQAPGEAMRLAMLGTHYR
QPFDWTAEGLEQARRGLDRLYSALRRVAGIAASPAEVPEGVMAALCDDLNTPKALAEVYD
LLGVLNRATTTEEQAKAKGALLAAGALLGLFQADPEVWLCGAGTGEEEGLAARVEDLICQ
RKAARQARDFARADAIRDELTQAGIVLEDGPNGTTWRKA