Protein Info for Rru_A0683 in Rhodospirillum rubrum S1H

Annotation: 3-deoxy-7-phosphoheptulonate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 88 to 104 (17 residues), see Phobius details PF01474: DAHP_synth_2" amino acids 5 to 442 (438 residues), 709.6 bits, see alignment E=5.9e-218 TIGR01358: 3-deoxy-7-phosphoheptulonate synthase" amino acids 5 to 448 (444 residues), 727 bits, see alignment E=3.2e-223

Best Hits

Swiss-Prot: 62% identical to AROF_ARATH: Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic (DHS1) from Arabidopsis thaliana

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 100% identity to rru:Rru_A0683)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase II (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWK8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Rru_A0683 3-deoxy-7-phosphoheptulonate synthase (NCBI) (Rhodospirillum rubrum S1H)
MATPWTPESWRAKPIDQVPDYPDAARLTDVEAELAKYPPLVFAGEARSLRAALAQVSQGK
GFLLQGGDCAESFAEFSANTIRDTFRVMLQMAVVLTYGAALPVVKVGRMAGQFAKPRSAP
LETIDGVALPSYRGDMVNGMEFEEGVRIPDPERLLRVYNQSASTLNLLRAFAQGGYADLT
QVHQWNLDFVEGSPQSERYRAFADRIAETIEFMRACGITPESVPQMRETDFYTSHEALLL
NYEQALTRIDSTTGKWYDCSAHLLWIGDRTRDPQGAHVEFLRGVANPVGVKAGPSMSPDG
LLELCDLLNPLNEPGRLSVIVRMGAGKVEAGLPPLIRAIEREGRKVVWSCDPMHGNTMKA
GSGFKTRDFKKILQEVTEFFAVHRAEGTHAGGVHFEMTGADVTECIGGARAVTEASLGDR
YHTHCDPRLNAHQALELAFLIAESLKTERMRIQAATVARAS