Protein Info for Rru_A0682 in Rhodospirillum rubrum S1H

Annotation: Glutathione reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 176 to 189 (14 residues), see Phobius details TIGR01424: glutathione-disulfide reductase" amino acids 4 to 446 (443 residues), 627.8 bits, see alignment E=4.4e-193 PF07992: Pyr_redox_2" amino acids 6 to 318 (313 residues), 225.1 bits, see alignment E=2.7e-70 PF13738: Pyr_redox_3" amino acids 121 to 302 (182 residues), 43.7 bits, see alignment E=4.5e-15 PF00070: Pyr_redox" amino acids 169 to 240 (72 residues), 74.6 bits, see alignment E=1.5e-24 PF02852: Pyr_redox_dim" amino acids 338 to 445 (108 residues), 126.4 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 56% identical to GSHR_PSEAE: Glutathione reductase (gor) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to rru:Rru_A0682)

MetaCyc: 40% identical to glutathione reductase (NADPH) (Escherichia coli K-12 substr. MG1655)
Glutathione-disulfide reductase. [EC: 1.8.1.7]

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWK9 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Rru_A0682 Glutathione reductase (NCBI) (Rhodospirillum rubrum S1H)
MADYDYDLLTIGAGSGGVRASRLAGGFGARVAVVEGSRIGGTCVMRGCVPKKLLVYGAQY
ANDLEDMIGYGWSMGGVAFDWPSLITAKNRELDRLEGVYRTMLRNGNVALLEGRARFLDA
HSVDIDGKTVTADKILIAVGGWPQMPVIPGIEHAITSNEALDLMVMPERLTIVGGGFIAV
EFASIFNALGVDVSVVIRKDKILRGFDADIRDTLTEELVRRGITIVPGTVINRIDKRPGG
GYRLIRTPGEAIDTDLVMYATGRAPNTAGLGLEAAGVKVAASGAVIVDEWNRTTVDTIYA
IGDVTDRIALTPVAINEAIAFAHTVFNDTPRVMDYENVASAVFSQPPVGTVGLTEEQARA
RGPVRIFRTRFRAMKHVLAGRDEKTMMKLVVDARTDRVLGCHMVGADAPEIIQGLAVALK
CGATKAQFDATIGIHPTAAEEFVTMRDPVPEPVFAQPAD