Protein Info for Rru_A0678 in Rhodospirillum rubrum S1H

Annotation: Multi antimicrobial extrusion protein MatE (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 21 to 49 (29 residues), see Phobius details amino acids 57 to 84 (28 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 171 to 197 (27 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 28 to 427 (400 residues), 148.2 bits, see alignment E=1.7e-47 PF01554: MatE" amino acids 28 to 186 (159 residues), 77.8 bits, see alignment E=3.9e-26 amino acids 281 to 404 (124 residues), 58.9 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0678)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWL3 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Rru_A0678 Multi antimicrobial extrusion protein MatE (NCBI) (Rhodospirillum rubrum S1H)
MSARHAAQQVNPFLTVPIGRLFVSNALPMAVVMSMGGVLNVVDGIFVGHFIGSDALAAVS
LAFPVAMVLSALTTLTGGGMSSLMARYLGAGDRGAAGRIFAETHGLVLAISVGLVVLWAV
VGAALVDSMAAGNPKVAGLAQDYLQIMILGAPAQLMLGVHADALRNEGRAGLIAALSVLV
NLFNIGANGLGIVVLGLGISGSALGTVAAQALGLALVIGVRGHSKGLLPLSVLRARNWLG
AWSQIIRLGLPLCLSFIGIAMVASVVIVSLRLSAGTDYNALVAAYGVVTRLLGFAFLPQM
AIALATQSITGNNAGAGRTDRARAALRLALGAAFLWCLPVVLAGVFAGTTLGSWFSDDPA
VIDAVAEILRPMMLFYAASGPVLVLALYVHALGQPGRTAALTLVKPWLLTPLLILALSIG
FGVSEMWLAFPMADAIILMLAVMIGRNVLHTAGTRAAHAEEGA