Protein Info for Rru_A0664 in Rhodospirillum rubrum S1H

Annotation: Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF00072: Response_reg" amino acids 8 to 109 (102 residues), 76.2 bits, see alignment E=5.8e-25 PF07568: HisKA_2" amino acids 153 to 226 (74 residues), 68.6 bits, see alignment E=1e-22 PF07536: HWE_HK" amino acids 153 to 221 (69 residues), 24.8 bits, see alignment E=7.3e-09 PF13581: HATPase_c_2" amino acids 244 to 337 (94 residues), 44.1 bits, see alignment E=5.3e-15 PF02518: HATPase_c" amino acids 254 to 342 (89 residues), 41.1 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0664)

Predicted SEED Role

"sensory transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWM7 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Rru_A0664 Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MTHASPRVLYIDDDPGTVRLAQKRLERHNLIVEVALSAREGLARIDQGGIDVVALDHEMP
GGTGMEVLSALAEREDAPPVVYVTGTGDTGVAVAAMKAGASDYVVKDVGGAFLDLLSIAI
DQALEIAQARRERSRAEREVREAKDRAEILLREVNHRVANSLALVAALVRMQGQVVEDPK
ARAALEETWGRIVAVGGIHRRLYTSEDVRFVGIDEYLKSLVADIESAMTSARCHHTIRVD
TQPVLIPTDKAVSVGVIVSELLTNACKYAYPEGSCGEIRLRCHQEGAEVLLDVEDFGQGR
DPGAPPRGTGLGTRIMAAMAKSLGSEVTYPAVSRGTKAQLRFSL