Protein Info for Rru_A0650 in Rhodospirillum rubrum S1H
Annotation: Cytidine/deoxycytidylate deaminase, zinc-binding region (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to TADA_AGRFC: tRNA-specific adenosine deaminase (tadA) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K01487, guanine deaminase [EC: 3.5.4.3] (inferred from 100% identity to rru:Rru_A0650)Predicted SEED Role
"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)
MetaCyc Pathways
- purine nucleotides degradation II (aerobic) (9/11 steps found)
- guanosine nucleotides degradation III (3/4 steps found)
- drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
- guanosine nucleotides degradation II (2/4 steps found)
- superpathway of guanosine nucleotides degradation (plants) (2/6 steps found)
- purine nucleotides degradation I (plants) (5/12 steps found)
- purine nucleobases degradation I (anaerobic) (6/15 steps found)
- purine nucleobases degradation II (anaerobic) (12/24 steps found)
- superpathway of purines degradation in plants (5/18 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.4.-
Use Curated BLAST to search for 3.5.4.- or 3.5.4.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RWP1 at UniProt or InterPro
Protein Sequence (159 amino acids)
>Rru_A0650 Cytidine/deoxycytidylate deaminase, zinc-binding region (NCBI) (Rhodospirillum rubrum S1H) MSATRPPDPALVLADPMGLALDLARAAAATGEVPVGAVITDAGGRPLAACANRTETDHDP TAHAEILAIRAACARRGDARLPDCTLWVTLEPCPMCASAIVHARLARVIFGAYDPKGGAV DHGVRLFAHPGCLHRPEVIGGMAESAAATLLRGFFQALR