Protein Info for Rru_A0634 in Rhodospirillum rubrum S1H

Annotation: Cyclic nucleotide-binding domain (cNMP-BD) protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 PF00027: cNMP_binding" amino acids 30 to 110 (81 residues), 33.6 bits, see alignment E=6.3e-12 PF00571: CBS" amino acids 150 to 197 (48 residues), 21 bits, see alignment 6.9e-08 amino acids 216 to 263 (48 residues), 26.8 bits, see alignment 1.1e-09 PF03445: DUF294" amino acids 289 to 417 (129 residues), 131.1 bits, see alignment E=5.4e-42 PF10335: DUF294_C" amino acids 456 to 599 (144 residues), 136.6 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to rru:Rru_A0634)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWQ7 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Rru_A0634 Cyclic nucleotide-binding domain (cNMP-BD) protein (NCBI) (Rhodospirillum rubrum S1H)
MGTFDFTISPFDLLAPAERDKLQGGADIAYFTAGERLTGPDRPGDALFVVMKGLVAEREG
DDLLTVHGAGDCVGALALIHGTPALICEAQEETIAHVIPRQLVLDLCRSNAAFERFFATS
LGDRLASHAQTRHLRGVAGFMVAKVGEAYLHPPIFVSGTLGLRDAALLMKRHRATSLLVT
GADGRVGVLSGSDLREWAIIREQPLSTPVEACATFDTVFVDVDDFLFNAQVLMTRHGIRR
LPVRRDGAVIGVLEMIDLLGYMSSHAHLVALRIDRADTLDDLALAAQALDPLIQGMGGSG
VRLRDVARMVSDLSRKLQRKLFSLIADPEIAQSCCLVVMGSEGRGEQLAKTDQDNALIIK
DGIDPESLRGLCNRFTEAMLTFGYPPCPGGMMVSNPAWAKSESALRDDVYGWITSPSEIG
FLNLAAFIDAEAVAGDGAMLARLKTLLFARLRGNSAFLSLFARPILAFDTPLGFFHQLLI
DHGSAGGGLDVKKGGIFPIVHGVRALALEHAITETSTFDRIEALRGLGALDDGVATDLVE
ALQALMALRLEARLGRSPQDGAVADTLIRAGSLTRSQHTALRDALLIVKRFKALLTHHFH
LESF