Protein Info for Rru_A0631 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 154 to 280 (127 residues), 39.4 bits, see alignment E=6.1e-14 PF00989: PAS" amino acids 170 to 271 (102 residues), 26.2 bits, see alignment E=1.3e-09 PF08447: PAS_3" amino acids 181 to 268 (88 residues), 76.9 bits, see alignment E=2.4e-25 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 284 to 443 (160 residues), 134.5 bits, see alignment E=2.9e-43 PF00990: GGDEF" amino acids 285 to 442 (158 residues), 151.4 bits, see alignment E=3.9e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0631)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWR0 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Rru_A0631 Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (NCBI) (Rhodospirillum rubrum S1H)
MTLETISSLLPMSAAGLAAVVSALAALGLGLGLWCARHRLRLLTAALEASGCGLITIEGG
TRVFQANRQAARLLGRPEGLARDTQARKLFGGTLTAAVQGPGDGQPVRGTAHRPDHGWFP
ATLQSLGPCGGFARQRRLWLLRDLSDAQELERLRETEERFNASQRFGRIGVWDWNTETNE
VFWSEEVFPMFGFTPAEITPTYDLFIAMVHPDDFVALTDSERACLSGTTLHDQEYRVIWR
DGSVHWIRETADVLRESDGTPRRMVGVIREVTEEKEAQRQALRIAMLDPLTGLPNRATFL
ERLEADLGQVDETGVAVPLALAFIDLDDFKPINDTYGHLMGDRVLMTIAKRLSEAVRPQD
MVARVGGDEFVALLRGCRDGARARTVAARLLDAVTAPVSIDTVIHRVRASIGISLYPSLV
STGDDLIATADQAMYVAKRAGGDPIRLHGE