Protein Info for Rru_A0624 in Rhodospirillum rubrum S1H

Annotation: 2-vinyl bacteriochlorophyllide hydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 56 to 78 (23 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 120 to 151 (32 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details TIGR02020: 2-vinyl bacteriochlorophyllide hydratase" amino acids 41 to 182 (142 residues), 189 bits, see alignment E=2.3e-60 PF07284: BCHF" amino acids 42 to 179 (138 residues), 208.5 bits, see alignment E=2e-66

Best Hits

KEGG orthology group: K11336, 3-vinyl bacteriochlorophyllide hydratase [EC: 4.2.1.-] (inferred from 100% identity to rru:Rru_A0624)

Predicted SEED Role

"2-vinyl bacteriochlorophyllide hydratase BchF (EC 4.2.1.-)" in subsystem Carotenoids or Chlorophyll Biosynthesis (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWR7 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Rru_A0624 2-vinyl bacteriochlorophyllide hydratase (NCBI) (Rhodospirillum rubrum S1H)
MIATVDGCPWSAHAGVLCVHRPHLTPSASRSQAARTPSKALYTAEERARRDRSPWTVVQG
ILAPVQFLVFLVSLYFVLRYLATGAGLEIANASVVVKTLVLYTIMITGSIWEKVVFGRWL
FAPVFFWEDVVSMLVLALHTSYLVALLAGGLAPAQMMTLALAAYAAYVVNAAQFVIKLRA
ARRGGVALAEGAQ