Protein Info for Rru_A0620 in Rhodospirillum rubrum S1H

Annotation: Light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF02374: ArsA_ATPase" amino acids 30 to 70 (41 residues), 28.4 bits, see alignment 2e-10 TIGR01281: light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein" amino acids 31 to 293 (263 residues), 475.5 bits, see alignment E=2.3e-147 PF00142: Fer4_NifH" amino acids 32 to 292 (261 residues), 296.1 bits, see alignment E=5.4e-92 PF01656: CbiA" amino acids 32 to 240 (209 residues), 43.3 bits, see alignment E=6.7e-15 PF13614: AAA_31" amino acids 32 to 87 (56 residues), 35.8 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 100% identical to BCHL_RHORT: Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein (bchL) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K04037, light-independent protochlorophyllide reductase subunit L [EC: 1.18.-.-] (inferred from 100% identity to rru:Rru_A0620)

MetaCyc: 80% identical to Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein (Blastochloris viridis)

Predicted SEED Role

"Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein ChlL (EC 1.18.-.-)" in subsystem Chlorophyll Biosynthesis (EC 1.18.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.-.-

Use Curated BLAST to search for 1.18.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWS1 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Rru_A0620 Light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (NCBI) (Rhodospirillum rubrum S1H)
MFDETMRQPPDGEGSVQVEMDPALHIETAKVFAIYGKGGIGKSTTSSNLSAAFSKLGKRV
VQIGCDPKHDSTFTLTKRLVPTVIDVLQAVHFHTEELRVEDFVYEGYNGVMCVEAGGPPA
GTGCGGYVVGQTVKLLKEHHILEDADVVVFDVLGDVVCGGFATPLQHAERALVVAANDFD
SIFAANRIAAAIQAKAKNYDVRLGGIIANRSVATDQIERFNARSGMRTLAHFPDLDVIRR
SRLCKSTLFEMEPSPELAAVQQEYLRLAEALWEGVEPLTATPLIDREIFDLLGFD