Protein Info for Rru_A0617 in Rhodospirillum rubrum S1H

Annotation: Photosynthetic reaction center, H-chain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01150: photosynthetic reaction center H subunit" amino acids 1 to 255 (255 residues), 411.7 bits, see alignment E=5.2e-128 PF03967: PRCH" amino acids 5 to 139 (135 residues), 176.2 bits, see alignment E=3.6e-56 PF05239: PRC" amino acids 148 to 216 (69 residues), 42.9 bits, see alignment E=3.9e-15

Best Hits

KEGG orthology group: K13991, photosynthetic reaction center H subunit (inferred from 100% identity to rru:Rru_A0617)

Predicted SEED Role

"Photosynthetic reaction center H subunit" in subsystem Photosystem II-type photosynthetic reaction center

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWS4 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Rru_A0617 Photosynthetic reaction center, H-chain (NCBI) (Rhodospirillum rubrum S1H)
MNKGDITGYMDVAQVVLYAFWIFFAGLIIYLRREDRREGYPLEDAISGKINSLQGLGSVF
SIARPKIFKLKTGATYAAPNFKRDAVAIKATRTAPTAGAPFEPTGNPMTDAVGPAAYALR
DELPDLTLGGQPAIVPLRVAPTFSVAAEDTDPRGLPVVDRKGAVAGKVTDLWIDRASIAI
RYLEVELAATPGRKVLLPFAATRINAKTKSKTVTVQSILARHFANVPTIAKTDSITRREE
DKVMAYYSSGYLYSDRV