Protein Info for Rru_A0613 in Rhodospirillum rubrum S1H
Annotation: Bacteriochlorophyll 4-vinyl reductase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to BCHJ_RHOCB: Bacteriochlorophyll synthase 23 kDa chain (bchJ) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
KEGG orthology group: K04036, divinyl protochlorophyllide a 8-vinyl-reductase [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A0613)Predicted SEED Role
"Protein BchJ, involved in reduction of C-8 vinyl of divinyl protochlorophyllide" in subsystem Chlorophyll Biosynthesis
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RWS8 at UniProt or InterPro
Protein Sequence (211 amino acids)
>Rru_A0613 Bacteriochlorophyll 4-vinyl reductase (NCBI) (Rhodospirillum rubrum S1H) MDPSPSATPIPPHGRIGPNAIIRVIDALRTTIGETACARIVEEAGLATYLDQPPQAMVDE TEVARLHGALRANLDRETAEAVCRDAGEATAGYLLANRIPAAAQSVIKLLPPGLGSRALL AGIGRHAWTFAGSGQFTIRHGTPLVLSIAHCPLCHALAGHAPACSYYAATFEGLYRVLIS PHARVREIACQAAGAPACQFAVTWTRAASAP