Protein Info for Rru_A0607 in Rhodospirillum rubrum S1H

Annotation: Adenine phosphoribosyl transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 59 to 77 (19 residues), see Phobius details TIGR01090: adenine phosphoribosyltransferase" amino acids 3 to 167 (165 residues), 198.8 bits, see alignment E=3.5e-63 PF00156: Pribosyltran" amino acids 47 to 159 (113 residues), 69.6 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 100% identical to APT_RHORT: Adenine phosphoribosyltransferase (apt) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 100% identity to rru:Rru_A0607)

MetaCyc: 45% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWT4 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Rru_A0607 Adenine phosphoribosyl transferase (NCBI) (Rhodospirillum rubrum S1H)
MNLKDHIREVPDFPKPGILFYDISTLLADPDAWQVTMGRMAKVVAPRLPDVLAGIESRGF
LVAAPLALKLGLGFVMVRKKGKLPGATVRHEYALEYGTDTVEVQEGAVLPGQRVVILDDL
LATGGTLNAASELLGKMGANVVGAACIIELSFLKGRERTKVPIDSLVAYDS