Protein Info for Rru_A0605 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 99 (16 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 27 to 326 (300 residues), 258 bits, see alignment E=5e-81

Best Hits

Swiss-Prot: 49% identical to Y2225_RHILO: UPF0324 membrane protein mlr2225 (mlr2225) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0605)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWT6 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Rru_A0605 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MMRFRSTAAVLPVPPAGVIAGMFAALPGLGLAFAVAGSGFLLHRLPGLDRISPLIVSIIL
GMAVNSLWAMPLRAKPGLRVASRRLLRLAVVLLGLQITFDHLRALGAPGMAVVALTLLLT
FLLTKALGRLIGVERGLAELIAVGTAVCGASAVVAANTVTQADDEDVAYAIACVTVFGTL
AMILYPLLAGALGLAPAAYGLWTGASIHEIAQVLAAGFQHGPQAGEAATVAKLARIALLA
PLVLAMGLWKSRGADTSAKGARPPIPWFVVGFIVMIGVSSLIHPSAALSQGAATLTSVLM
TVALAAMGLETSLGKLRARGLRPLLLGAASWMVVGLGALALVKVLTTGGGA