Protein Info for Rru_A0600 in Rhodospirillum rubrum S1H

Annotation: Phosphate transport system permease protein 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 204 to 233 (30 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details PF11812: DUF3333" amino acids 11 to 158 (148 residues), 176.6 bits, see alignment E=3.7e-56 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 184 to 423 (240 residues), 212.8 bits, see alignment E=2.6e-67 PF00528: BPD_transp_1" amino acids 225 to 422 (198 residues), 65.1 bits, see alignment E=7.1e-22

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to rru:Rru_A0600)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWU1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Rru_A0600 Phosphate transport system permease protein 2 (NCBI) (Rhodospirillum rubrum S1H)
MATHNTELVRAGLKRRYRQERWFRGLGLAAILTALAMLLTLFVTIFSNGVSAFVTTELVL
DVPVTAAEVDPQGTRDPAVLSAANYRKLVSDAMSALFPEVTDRRERRVLMGIVSDGAAYR
LRAQVMADPSLIGQTVRLNVPVSSDYDMLAKGLVDRDSLEGDRRLADNQITYFLSLEERG
LITKTFNSGLFTEGDSRQPELAGIWGGVVGSVYVLLVTLALSFPIGVATAIYLEEYAPRN
WFTDLIEVNINNLAAVPSIVFGLLGLAVFLNVFGMPRSAPVVGGLVLTLMTLPTIIIASR
AALTSVPPSIREAALGVGASKMQMVTHHVLPLAMPGMLTGTIIGMAQALGETAPLLMIGM
VAFIADIPSGPMAPATVLPVQIFLWSDSPERAFVERTSAAIIVLLAFLVLMNAGAVLLRK
KFERKW