Protein Info for Rru_A0594 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function UPF0191 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 51 to 165 (115 residues), 68.1 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 100% identical to MSRQ_RHORT: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0594)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWU7 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Rru_A0594 Protein of unknown function UPF0191 (NCBI) (Rhodospirillum rubrum S1H)
MTGGSVLKDRDRLGRIAVFVACLLPLVWYGARFVGGDLGANPIEAFTRKLGEWGLIFLLA
SLAATPARLLWGWTFPLRRRRMVGLFAFFYVCLHLLSYIGLDQFFDWGAIWADIVKRTYI
TVGMAALLLLVPLAVTSTRGMVRRLGGKRWIALHRLVYPAAVLGVLHYMLMVKADLSEPL
IFAGILGLLLAVRLVPAVRRRRSGRAPS