Protein Info for Rru_A0587 in Rhodospirillum rubrum S1H

Annotation: Chaperonin Cpn60/TCP-1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 TIGR02348: chaperonin GroL" amino acids 3 to 528 (526 residues), 868.9 bits, see alignment E=5.7e-266 PF00118: Cpn60_TCP1" amino acids 23 to 524 (502 residues), 254.8 bits, see alignment E=8.1e-80

Best Hits

Swiss-Prot: 100% identical to CH602_RHORT: 60 kDa chaperonin 2 (groL2) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K04077, chaperonin GroEL (inferred from 100% identity to rru:Rru_A0587)

MetaCyc: 68% identical to chaperonin GroEL (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family chaperone GroEL" in subsystem GroEL GroES or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWV4 at UniProt or InterPro

Protein Sequence (548 amino acids)

>Rru_A0587 Chaperonin Cpn60/TCP-1 (NCBI) (Rhodospirillum rubrum S1H)
MAAKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEI
ELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGI
DLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEA
KGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILLHEKKLSGLQALLPVLEAV
VQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQV
ISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDY
DREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALL
HAIRSLDSVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYN
AQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIPEKKDAMPSPDMGGM
GGMGGMGF