Protein Info for Rru_A0575 in Rhodospirillum rubrum S1H

Annotation: Peptidase U62, modulator of DNA gyrase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF01523: PmbA_TldD_1st" amino acids 30 to 94 (65 residues), 43.8 bits, see alignment E=3.5e-15 PF19290: PmbA_TldD_2nd" amino acids 122 to 228 (107 residues), 62.9 bits, see alignment E=5.3e-21 PF19289: PmbA_TldD_3rd" amino acids 235 to 451 (217 residues), 243.5 bits, see alignment E=2.3e-76

Best Hits

KEGG orthology group: K03592, PmbA protein (inferred from 100% identity to rru:Rru_A0575)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWW6 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Rru_A0575 Peptidase U62, modulator of DNA gyrase (NCBI) (Rhodospirillum rubrum S1H)
MTDLAKTAANALGLLEDLVAKAVAAGATAADAVLVDGASLAVTHRLGKLEKLERSEGGDI
GLRVLIGGRQAIVSSADRRPDALAALVERAVAMARTVPEDPFAGLAEPGQLARDLPAIDN
FDPTEPSAEALTELVRALEDEARSVPGVTNSEGAEASWGLSTVALVGSNGFSHAYHASHS
GMSVSVVAGTNETGMEGDYDYSTAVYFADLRDPLEVGREAGRRATRRLGAKRLATGRLPV
VFDPRVSRGLVGHLLGAINGGGIARGTSFLKDRLGEAVFAPGIRIIEDPHRPRGLRSKPC
DAEGLANRRRTLVEDGRLTSWILDLRSARQLGLESTGHASRGTGSAPSPSTTNVWLEAGP
LSPQDLMADIEDGLYVTDLVGQGVNGLTGDYSRGAAGFRIEKGVLTTPVNEITIAGNLIE
MFAGLTPANDLDLRYGTDAPTVRLAAMTIAGG