Protein Info for Rru_A0574 in Rhodospirillum rubrum S1H

Annotation: Carboxylyase-related protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 466 (461 residues), 508.3 bits, E=8.2e-157
• PF20695: UbiD_N
  • amino acids 11 to 92 (82 residues), 79.4 bits, E=2.7e-26
• PF01977: UbiD
  • amino acids 126 to 333 (208 residues), 260.7 bits, E=1e-81
• PF20696: UbiD_C
  • amino acids 339 to 463 (125 residues), 166.3 bits, E=4.8e-53

Best Hits

Swiss-Prot: 60% identical to UBID_SACD2: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to rru:Rru_A0574)

MetaCyc: 53% identical to 4-hydroxy-3-polyprenylbenzoate decarboxylase (Cereibacter sphaeroides)
RXN-9231 [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (4/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

See Q2RWW7 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Rru_A0574 Carboxylyase-related protein (NCBI) (Rhodospirillum rubrum S1H)
MPFDSLRDFMALLEREHNLVRVRAPVSPVLEMTEIQTRLLDEKGPAVLFENVRRPDGSAY
AMPMLVNMFGTVERVALGMDRTPAQLREVGEMLAFLKQPEPPGGWREALEMLPLLKTVLA
MKPRTVSKAPCQQVVLKGKDIDLGLLPIQSCWPGEPAPLITWPVVVTQGPQASGKGARRE
DAFNLGIYRMQVTGRDTALMRWLKHRGGAQHWQRWKRDHAEPLPAAVVIGADPGTILAAV
TPVPDTLSEYQFAGLLRGRKVELVDCVSVPLKVPATAEIVLEGHVMLDEYGDEGPYGDHT
GYYNAVESFPVFRISAITMRKDPIYLSTFTGRPPDEPSVLGEALNEVFIPLLTQQFPEIV
DFWLPPEGCSYRIAVVSMRKAYPGHAKRVMMGVWSFLRQFMYTKFVIVVDDDINARDWKD
VMWAISTRMDPARDITVVTGTPIDYLDFASPESGLGGKIGLDATDKMAPETHREWGRKLR
MSDEIIETVTRKWTDYGLPGSGKPIWK