Protein Info for Rru_A0558 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 PF13188: PAS_8" amino acids 141 to 167 (27 residues), 19.9 bits, see alignment (E = 1.3e-07) PF08448: PAS_4" amino acids 143 to 246 (104 residues), 27.3 bits, see alignment E=9.3e-10 PF13426: PAS_9" amino acids 148 to 238 (91 residues), 20.7 bits, see alignment E=1.1e-07 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 259 to 420 (162 residues), 147.4 bits, see alignment E=3.2e-47 PF00990: GGDEF" amino acids 261 to 417 (157 residues), 172.6 bits, see alignment E=1.5e-54 PF00563: EAL" amino acids 438 to 673 (236 residues), 224.9 bits, see alignment E=2.5e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0558)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWY3 at UniProt or InterPro

Protein Sequence (683 amino acids)

>Rru_A0558 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) (NCBI) (Rhodospirillum rubrum S1H)
MSASPQAPTPPDRSSPSVSSNLGAEGAGGRRLCGSVVLSAGKILSVDKTLWQALGLSAES
LSGLPFLSFLEDPSREVLAARLRLAGPPWDLRTALRVDGRAIPVVLRGDGAADRTTDTPL
QVILITLAPQEGEVEPVSQSALFDHIPLGVMLSDGLGRIAYANPAFLAEDIAAVRALLGA
TPQALATGYLHEGLARTLWEDLLCGRVWRNDVDLPTADGQRTHSRLTIIPLRRDDGAVDR
LMTVIEPRSPATDSQAWQQVNHDTLTGLPNRVLFQDRLLTALASARRRNDQLAVLFVDLD
HFKTVNDSLGHSFGDQLLQQVATRLSQCLRDSDTLARMGGDEFTIALTGDGHQRDYAMIA
NRILETLRRPFTLEGGHEVLIGSSIGITLFPNDAEDVDTLLRNADTAMYRAKASGRNAFQ
FFTEEMNREIQSHLDLENALRRAVRAMDLTIHYQPVVDSATLAVVSAEALVRWPLADKGF
IPPSRFIPVAEELGLIDEIGGWVLWNACTQAKVWQAQGAKAFRVSVNVSWRQLRNPDFAL
RVREALEGTGLGAAFLELEITEGMVLRDPQGIAPALMALSEMGVALAIDNFGSGHSSIKC
LRQFPFSILKLDRSCVADVLTSHEDAVLVETAAIMARRLGLTVVAEGVETHAQLEFLREH
YCDLIQGYLFGRPLPPEDFARML