Protein Info for Rru_A0545 in Rhodospirillum rubrum S1H

Annotation: Flagellar FliF M-ring protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 19 to 469 (451 residues), 297.6 bits, see alignment E=1.2e-92 PF01514: YscJ_FliF" amino acids 39 to 212 (174 residues), 211.2 bits, see alignment E=1.1e-66 PF08345: YscJ_FliF_C" amino acids 245 to 408 (164 residues), 145.9 bits, see alignment E=1.2e-46

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to rru:Rru_A0545)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWZ6 at UniProt or InterPro

Protein Sequence (551 amino acids)

>Rru_A0545 Flagellar FliF M-ring protein (NCBI) (Rhodospirillum rubrum S1H)
MNSFVQTMRNLGPVRLAALAGVAIALIGFVIYVASRLSGTSMELLYGDLAPADAKQIIAQ
LEERNIPYQMANDGRSVLVPSDQVLKLRVQMAESALPSGATVGYEIFDSASALGSTQFTQ
NINMVRALEGELARTVRTIQGVEGARVHLVLPKREPFTRDQVAPSASVVLLMKGRRLQPE
QVVAVQNLVAAAVPGMKPGQVSIIDERGTLLTRGMGEEGALIAQNQDELRKAEERRLAQS
IEQLLERTIGVGKVRAEVVADMDFNRIVTSRESFDPNGQVVRSTTTVDEQNKSSDAVSNV
SVQQNLPEAQFAGNGGAPTSQTSENRTEETVNYEITKIVTNEVKEAGVVKRLSVAVMVDG
TSTTNDAGVTTWQPRSDDEMQKITSLVRSAMGYDQARGDQIEVVNMQFIDPGALFDDAAA
WEFLGFTKAEVMKMAEGLGVAVVAILIILLVVRPLVQRAFENLPSGADQGGAGLLTAEMQ
SHPQLTGPGGGSIPAGMLGMPDEMDDAEELIDIDKVEGRVKASSLRKIGEIVDKHPEEAL
SIIRNWLYQES