Protein Info for Rru_A0535 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF00892: EamA" amino acids 8 to 141 (134 residues), 57.1 bits, see alignment E=1.2e-19 amino acids 156 to 292 (137 residues), 35.7 bits, see alignment E=5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0535)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX06 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Rru_A0535 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MIWAVSTMSVILFCVVVLCWGFTWFGIHLQLGTIAPEVSILWRFLLAAIVLAFGLAASGR
FKPAPLAHHPWFALLGLCLFSTNFVLMYSATQYIASGIVSVVFCMATVFNAANQWLFLKR
VPAVRTVGGALIGIAGIALLFGESFLHVEASADTALGVALALGGTYVFSLGNLVSLRATA
SGTDLPNAVVRAMAWGSVFLALFVLARGVPFAMDWSARYVGSLLYLAIPGSVIGFTAYLS
LVSRIGPDRAAYSAVLFPVVALTVSTLFEGYQWSAWAMAGLPLILIGNLVIFARLPARWR
RAAA