Protein Info for Rru_A0518 in Rhodospirillum rubrum S1H

Annotation: molybdenum cofactor biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 33 to 365 (333 residues), 353.1 bits, see alignment E=6.7e-110 PF04055: Radical_SAM" amino acids 47 to 212 (166 residues), 110.3 bits, see alignment E=1.8e-35 PF13353: Fer4_12" amino acids 50 to 124 (75 residues), 22.7 bits, see alignment E=1.6e-08 PF06463: Mob_synth_C" amino acids 218 to 344 (127 residues), 127.7 bits, see alignment E=4e-41

Best Hits

Swiss-Prot: 61% identical to MOAA_BRUSI: GTP 3',8-cyclase (moaA) from Brucella suis (strain ATCC 23445 / NCTC 10510)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to rru:Rru_A0518)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX23 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Rru_A0518 molybdenum cofactor biosynthesis protein (NCBI) (Rhodospirillum rubrum S1H)
MKAMTRSFPPLPQAAARPLAEGPRPQVEPPRPLVDAFGRTVTYLRLSVTDRCDLRCAYCM
AEDMVFLPKRDLLSLEELETVALAFIRRGVRKIRITGGEPLHRRGLMGLIENLGRTLRPA
ERECGLDELTLTTNATRLAEVAGDLAARGVRRINVSLDTLRPERFRAITRRGDLDRVMAG
LAAADRAGLAVKINTVALRGVNEDEIDALLAWCGTRGYDLTFIETMPLGDTGTDRIDQYL
PLTEVQARLKRHWTLSESAHRTGGPARYWDCRETGTRLGFITPLTHNFCEGCNRVRLTCT
GMLYLCLGQDDSLDLRAVLRDGGGAAALDEALDRAMTKKPKGHDFIIDRTSRAPAVSRHM
STTGG