Protein Info for Rru_A0497 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00005: ABC_tran" amino acids 33 to 174 (142 residues), 134 bits, see alignment E=8.6e-43 PF13304: AAA_21" amino acids 97 to 208 (112 residues), 31 bits, see alignment E=4e-11 PF08402: TOBE_2" amino acids 287 to 362 (76 residues), 44.3 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to rru:Rru_A0497)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX43 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Rru_A0497 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MLGICSSGASTNSMAYLDLKDLHKAFGAARVVSDFTLAVERGEFVSFLGPSGCGKTTVLR
MIGGFETPSSGRILIDGQDVTALTPARRKVGMVFQAYALFPNLTVAENVAFGLKVAREPA
SQTARRVDEMLELIKLPQLKDRYPYQLSGGQQQRVALARALAVRPKILLLDEPLSALDAK
IRVSLREEIRAVQRELGITTVFVTHDQEEALSMSDRVVVMHNGRADQVGAPFEIYNAPKT
RFVASFVGTLNLLEGVALAPDRLTIEGQGITTTRGLAGAAVGATVSLALRPEAIGPLPTP
ERTNKLEATVVDVGFQGALVRVKVAVGRQSLTYVTFNAPNSPPPERGTALTLWFGPDDVL
VLADEA