Protein Info for Rru_A0475 in Rhodospirillum rubrum S1H
Annotation: NADH:flavin oxidoreductase/NADH oxidase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to OPR1_ORYSJ: 12-oxophytodienoate reductase 1 (OPR1) from Oryza sativa subsp. japonica
KEGG orthology group: K10680, N-ethylmaleimide reductase [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A0475)MetaCyc: 50% identical to nitroglycerin reductase (Agrobacterium tumefaciens)
1.7.1.-; 1.7.1.-
Predicted SEED Role
"N-ethylmaleimide reductase (EC 1.-.-.-)" (EC 1.-.-.-)
MetaCyc Pathways
- nitroglycerin degradation (2/5 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RX65 at UniProt or InterPro
Protein Sequence (365 amino acids)
>Rru_A0475 NADH:flavin oxidoreductase/NADH oxidase (NCBI) (Rhodospirillum rubrum S1H) MSSPFPHLFDPLALGDLHLPNRIVLAPLTRSRALPGEVAGALTARYYAQRASGGLLISEG TQISPSGRGYPRTPGIHSPEQIAGWKGVTEAVHAAGGRIFAQLWHVGRISHRSLQPGGVL PVAPSAIRPKTKIFTESGLVALETPRALDTAEMADIVASFRAAAENARAAGFDGVEIHAA NGYLLDQFLRDGTNHRDDAYGGSIDNRLRLVLEVVEAVLGVWDKARVGLRLSPANPFNDI LDSTPQATFEAVVSALDGFGLGYLHMVEGSLGSGEGAPEIDFAALRRLWQGVYMANGGYD GPRAEAALASGHAQLVSFGTAYLANPDLPERLRTNAPLNTPDSTTFYQGEDKGYVDYPTL ADGAA