Protein Info for Rru_A0472 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details TIGR03426: rod shape-determining protein MreD" amino acids 28 to 173 (146 residues), 51.4 bits, see alignment E=5.7e-18 PF04093: MreD" amino acids 32 to 173 (142 residues), 48.2 bits, see alignment E=6.7e-17

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 100% identity to rru:Rru_A0472)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX68 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Rru_A0472 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MARRGGLKSTYDPTQPTLWQRLDWLARRLVPVGLTLLLLLMSVAPSRLPGFVHIAPMIAL
ISIYYWAVCRPEVMGYGSAFVLGLVEDSLTGAPLGVGALVLLLTQAVVATQYKFFLNKPF
LVTWWAFALVAGVAAVVKWLAVSAIYGTFVDGTALVFSTLFTVAVYPPFAWLFGRVHHML
FREA