Protein Info for Rru_A0457 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF891 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 TIGR02683: putative addiction module killer protein" amino acids 3 to 94 (92 residues), 130 bits, see alignment E=1.6e-42 PF05973: Gp49" amino acids 21 to 91 (71 residues), 25.8 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 53% identical to Y1419_HAEIN: Uncharacterized protein HI_1419 (HI_1419) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0457)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX83 at UniProt or InterPro

Protein Sequence (98 amino acids)

>Rru_A0457 Protein of unknown function DUF891 (NCBI) (Rhodospirillum rubrum S1H)
MIELKQTETFRKWRTRLKDVRARAIIAARLDRLSQGHTGDSEPVGDGISELRIHYGPGYR
LSFQKRGQTIVVLLCGGDKSTQAKDIQTAKRLAEIGKE