Protein Info for Rru_A0429 in Rhodospirillum rubrum S1H
Annotation: Guanylate kinase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to KGUA_RHORT: Guanylate kinase (gmk) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
KEGG orthology group: K00942, guanylate kinase [EC: 2.7.4.8] (inferred from 100% identity to rru:Rru_A0429)MetaCyc: 50% identical to guanylate kinase (Escherichia coli K-12 substr. MG1655)
Guanylate kinase. [EC: 2.7.4.8]; T(2)-induced deoxynucleotide kinase. [EC: 2.7.4.8, 2.7.4.12, 2.7.4.13]
Predicted SEED Role
"Guanylate kinase (EC 2.7.4.8)" in subsystem MLST or Purine conversions (EC 2.7.4.8)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
- superpathway of purine nucleotide salvage (13/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
- guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
- pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
- purine deoxyribonucleosides salvage (4/6 steps found)
- dZTP biosynthesis (3/5 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
- superpathway of pyrimidine deoxyribonucleoside salvage (4/9 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.4.12 or 2.7.4.13 or 2.7.4.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RXB1 at UniProt or InterPro
Protein Sequence (218 amino acids)
>Rru_A0429 Guanylate kinase (NCBI) (Rhodospirillum rubrum S1H) MSAPSSAPALIPRRGMMLVLSSPSGAGKTTISRALLAEEDGLEMSVSVTTRAPRPGERDG EHYHFIDVARYMALTKDDGLLEHARVFENYYGTPRAPVEAALARGCDVLFDIDWQGTQQV AEKARTDLVSIFILPPSVGELERRLKGRAQDSDAVVAARMAKAMDEISHYFEYDYIIVND DLDRSIADVRAILRAERLKRARRIGLAEFVNRMRGAGE