Protein Info for Rru_A0414 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein S6 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00166: ribosomal protein bS6" amino acids 1 to 94 (94 residues), 77.5 bits, see alignment E=3.6e-26 PF01250: Ribosomal_S6" amino acids 4 to 92 (89 residues), 100 bits, see alignment E=3.4e-33

Best Hits

Swiss-Prot: 100% identical to RS6_RHORT: 30S ribosomal protein S6 (rpsF) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02990, small subunit ribosomal protein S6 (inferred from 100% identity to rru:Rru_A0414)

MetaCyc: 33% identical to 30S ribosomal subunit protein S6 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S6p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXC6 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Rru_A0414 Ribosomal protein S6 (NCBI) (Rhodospirillum rubrum S1H)
MALYECVLIARQDISNAQVDTMGDEVSAILSEGGGSVSKREYWGLRTLNFRIKKNRKGHY
LLLNIDAPAPAVHELDRRLRLNEDVIRHMTVKVEELEEAPSAMMQKNDRPERGGRRGDRF
GDRPERGDRPDRGDRGGDRGGDRGDRAPRGERRPLREGAE