Protein Info for Rru_A0411 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein L9 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR00158: ribosomal protein bL9" amino acids 2 to 146 (145 residues), 132.5 bits, see alignment E=8.3e-43 PF01281: Ribosomal_L9_N" amino acids 2 to 47 (46 residues), 72.8 bits, see alignment 1.3e-24 PF03948: Ribosomal_L9_C" amino acids 65 to 146 (82 residues), 85.4 bits, see alignment E=2.9e-28

Best Hits

Swiss-Prot: 100% identical to RL9_RHORT: 50S ribosomal protein L9 (rplI) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 100% identity to rru:Rru_A0411)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXC9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Rru_A0411 Ribosomal protein L9 (NCBI) (Rhodospirillum rubrum S1H)
MMEVILLERIENLGFMGDIVKVKDGYARNFLLPQKKALRKSKSNLEYFNAQKVELEALNL
KRKGEAEAVAVKLDGLNLVMVRQAGESGQLYGSVSARDITDSLKAEGFVIARSQVLLNHP
IKDLGRYETRVSLHPEVIVTITVVVARSEAEAQASAAAAAALLERPEDAEEAVANEEEAE
AALLDDEDADEYEQG