Protein Info for Rru_A0408 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF140 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 41 to 255 (215 residues), 243.4 bits, see alignment E=1.6e-76 PF02405: MlaE" amino acids 43 to 252 (210 residues), 270.3 bits, see alignment E=5.7e-85

Best Hits

Swiss-Prot: 62% identical to Y080_RICFE: Probable ABC transporter permease protein RF_0080 (RF_0080) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to rru:Rru_A0408)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXD2 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Rru_A0408 Protein of unknown function DUF140 (NCBI) (Rhodospirillum rubrum S1H)
MNFLAIIGRVFLTFLRHVGRLSVFTGTALSHCVRPPFFPRLIGRQLVEIGYYSLPVVGLT
AIFTGMVLSLQSHSGFARFSAEGATATVVVLSMTRELGPVLAGLMVAGRIGAAMAAEIGT
MKVTEQIDALTTLATNPYKYLVVPRLIAGVTMLPILVLTADIIGVFGGYLIGVYKLGFNP
SNYIASTWEFLEPMDVISGLVKASVFGFIIALMGCYHGSQSKGGAQGVGAATTNAVVSAS
ILILVCNYMITELFFAQ