Protein Info for Rru_A0404 in Rhodospirillum rubrum S1H

Annotation: Amidophosphoribosyl transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR01134: amidophosphoribosyltransferase" amino acids 22 to 468 (447 residues), 531.3 bits, see alignment E=1.3e-163 PF13522: GATase_6" amino acids 86 to 215 (130 residues), 73 bits, see alignment E=3.8e-24 PF13537: GATase_7" amino acids 102 to 219 (118 residues), 71.8 bits, see alignment E=7.7e-24 PF00156: Pribosyltran" amino acids 291 to 391 (101 residues), 34.7 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 54% identical to ASE1_ARATH: Amidophosphoribosyltransferase 1, chloroplastic (ASE1) from Arabidopsis thaliana

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to rru:Rru_A0404)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXD6 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Rru_A0404 Amidophosphoribosyl transferase (NCBI) (Rhodospirillum rubrum S1H)
MAPTDIDFSTDPFDDDKLREECGVFGVFADPNAASHTALGLHALQHRGQEAAGIVTFDGT
QFHSVKGPGHVSENFKSETVISQLVGSSAIGHVRYSTTGGAVMRNIQPLFAEFAFGGLAI
AHNGNLTNAMTLRERLVQRGCLFQSTSDTEVIVHLIAISICSSVEDRIIDALRQVQGAYS
IVALTNNALIGVRDPMGIRPLVLGQLDGAYIFASETCALDIIGADYIRDVEPGELIIITG
KEVRSLRPFPQTPSHFCVFEYIYFARPDSIVEERSVYEVRKAIGRELARESAVEADVVVP
VPDSGVPSALGYAAEAGLPFEYGIIRNHYVGRTFIQPTDKTRNLGVKRKHNPNRSQLEGK
RVILVDDSIVRGTTSTKIVEMVRQAGAREVHMRISSPPTAYPCFYGIDTPEREKLLAANY
SVEDMAKLLGVDSLAFVSLDGLYRAAGVESRNAERPQFCDACFSGHYPVPNQDRAQKSHP
LQLALLND