Protein Info for Rru_A0395 in Rhodospirillum rubrum S1H

Annotation: PpiC-type peptidyl-prolyl cis-trans isomerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13145: Rotamase_2" amino acids 122 to 244 (123 residues), 68.1 bits, see alignment E=1.9e-22 PF13616: Rotamase_3" amino acids 139 to 232 (94 residues), 76 bits, see alignment E=5.4e-25 PF00639: Rotamase" amino acids 152 to 230 (79 residues), 67.7 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 100% identity to rru:Rru_A0395)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXE5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Rru_A0395 PpiC-type peptidyl-prolyl cis-trans isomerase (NCBI) (Rhodospirillum rubrum S1H)
MMSPRARRLALAGVLALPLFAGPALAADPDPVVAVVNGADVHLSAVQERFAELQASQPQL
GGLPLAMVYEQLLNSVVEAELVTEAGRKAGLANDPEVKHRLDRLLDRLIAGAYMQKVVDE
DVTDAAVKARYNEMKAEFKPEKEVHARHILLETEDAAKDAIKKIEGGADFTKLASELSTG
PSAQTGGDLGFFTKDRMVAPFAEAAFAMKVGEVSKAPTKTEFGWHVIKIEEVRDTTFPPV
EEMESHIRDELANAAVEKNVAGLKESAKVKLFAADGKTTLEEAKAAAEKQRAEQEKAGAK
DAAPAAKP