Protein Info for Rru_A0379 in Rhodospirillum rubrum S1H

Annotation: Flavodoxin, long chain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01752: flavodoxin
  • amino acids 3 to 160 (158 residues), 184.4 bits, E=6.3e-59
• PF12724: Flavodoxin_5
  • amino acids 5 to 82 (78 residues), 30 bits, E=6.3e-11
• PF00258: Flavodoxin_1
  • amino acids 5 to 155 (151 residues), 72.3 bits, E=4.7e-24

Best Hits

Swiss-Prot: 45% identical to FLAV_SYNP2: Flavodoxin (isiB) from Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)

KEGG orthology group: K03839, flavodoxin I (inferred from 100% identity to rru:Rru_A0379)

MetaCyc: 45% identical to flavodoxin A (Salmonella enterica enterica serovar Typhimurium)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Flavodoxin 1" in subsystem Flavodoxin

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (9/9 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (6/6 steps found)
• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (27/36 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

See Q2RXG1 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Rru_A0379 Flavodoxin, long chain (NCBI) (Rhodospirillum rubrum S1H)
MGTTVIYGSDGGTTQGVAKRIASPLQAKVVDIKVATTDDLEGCDLLILGAPTYGLGDLQC
DWESRIGVLDSAKLTGKRVALFGTGDQIGYPDSFVDAMGILYDRVVALGATVVGFTATQG
YDYSYSLAERDGQFVGLALDEDNQSSLTGKRIAAWVDHLK